Trying to Get Pregnant

Weekly Randoms w/o 3.7

Re: Weekly Randoms w/o 3.7

  • @anniemarie887 I love the honesty in this article and the format was truly compelling. More stories like this need to be told and shared, thank you.
    Daisypath Anniversary tickers
  • Loading the player...
  • @anniemarie887 thank you for sharing this. So needed. I wish we were doing more to make pregnancy loss and other aspects of TTC not a taboo subject. 
    MY CHART
    TTC History
    Me: 38, MH: 37 | Met 02/2009 | Started Dating 08/2017 | Married 02/02/2020
    TTC #1 since 02/2020
    2009 | Dx PCOS; likely a misdiagnosis
    07/14/20 | Dx Hashimoto's Thyroditis
    07/21/20 | 1st RE appointment
    07/2120 - 08/20/20 | so much testing; no signs of PCOS
    08/20/20 | Dx Unexplained; AMA
    09/08/20 | IUI #1 Clomid + Trigger + Prometrium | BFN
    09/30/20 | Urology consult; more testing required
    10/2020 | Clomid + OPK + TI + Prometrium | BFN
    10/26/2020 | Starting 2nd IUI cycle, with Letrazole and with a new RE / different clinic
    11/03/2020 | New Dx "poor egg quality"; IUI cancelled in favor of Trigger + TI + Prometrium | BFN
    11/26/2020 | Combo IUI (Clomid + Menopur) + Trigger + Prometrium | BFN
    12/20/2020 | Combo IUI (Clomid + Gonal-F) + Trigger | IUI Cancelled due to thin lining; TI only | BFN
    01/14/2021 | Combo IUI (Letrazole + Menopur) + Trigger | BFN
    02/06/2021 | Switched to a new RE (TEW) ; trying naturally until we complete additional testing 
    03/14/2021 | Hybrid Double IUI, with Zymot (Letrazole, Gonal-F) + Trigger + Endometrin | Ovulated 4 mature eggs but still a BFN ☹️
    04/07/2021 | Natural cycle while we regroup | BFN
    04/09/2021 | Employer announces fertility benefits starting 05/01/2021! | Search for a new doctor who accepts insurance
    05/10/2021 | New RE consult & plan for IVF
    05/13/2021 | Mid-luteal IVF cycle #1 interrupted; had to get cancer genetic screening done to make sure I didn't have the same SDHA gene mutation as MH. 
    06/10/2021 | Aygestin priming IVF cycle #1; opted to Cx after 9 days of stims since only 5-6/12 follicles responded
    07/26/2021 | Attempt #2 at IVF cycle #1 (mid-luteal start): 8 retrieved, 8 MII, 6 fert (1 PN3), 3 Day 5 & 6 blasts: 3AA, 3AA, 6AB; 3 euploid
    08/09/2021 | Rest cycle / unmedicated TTC | Shockingly, a BFP! EDD: 5/25/202 | CP at 4w4d
    09/23/2021 | IVF cycle #2 (mid-luteal start): 14 retrieved, 13 MII, 11 fert, 5 Day 5 & 6 blasts: 2 x 3AA, 2 x 3AB, 3BB; 2 euploid
    11/12/2021 | IVF cycle #3 (mid-luteal start): cancelled due to ovaries being on vacation
    12/20/2021 | Rest cycle / unmedicated TTC + Pregmune Immunology Testing; BFN
    01/22/2022 | Rest cycle / unmedicated TTC + understanding uncovered immunological issues; BFN
    02/18/2022 | Mock transfer cycle! ERA, ReceptivaDx, EMMA/ALICE; start Prednisone to address NK activity
    03/16/2022 | Final, "Hail Mary" super-ovulation + TI cycle before FET; BFP! EDD: 12/21/2022 | MMC 05/08/2022
    05/20/2022 | D&C; recovering... 
    06/21/2022 | Trying naturally until October 2022
    07/21/2022 | BFP! EDD 04/02/2023


  • @anniemarie887 thank you for sharing this. It is something so many of us go through, but when it happens you don't know of anyone it has happened to, and you feel so alone. There needs to be more discussion around loss so that women feel like they have people to turn to, and to open up and share their stories. 
  • @anniemarie887 wow this brought tears to my eyes. That was heartbreaking and also brought back so many memories.

    TTC History:
    Me: 36 H: 40 Married 2015. Together since 2010.
    TTC: Sept 2016-Oct 2017
    BFP Oct 2017. DD born July 2018.
    TTC: March 2020. BFP March 2020
    Due date was Nov 2020
    DS born Sept 2020. DS passed away Nov 2020 due to prematurity and birth trauma.
    TTC: March 2021
    IUI #1 Nov 2021, BFN
    IUI #2 Dec 2021 BFP.  MC Jan 2022
    IUI #3 Aug 2022 BFN
    IUI #4 Sept 2022 BFN
    AMH test came back at .081. Was going to move on to IVF with DE, but have decided not to. Will be leaving it up to the universe now.



  • you're all welcome, i was hoping this wouldn't upset anyone with how frank it all is.

    also - who is this dude on the IF tread, def reported that troll/bot
    abjm0325optimistgardenerfantasyflytekeikilove
  • Is there a way to view PMs on the app that I'm just not seeing or do I have to go through the website?
  • anniemarie887anniemarie887 member
    edited March 2022
    @fantasyflyte if you have an iphone (i won't assume this app looks the same on android) and you are for ex on the ttgp "home" page where all the threads are... look toward the top left corner, right above trying and you should see "inbox"
  • Wait.. who IS that dude in IF thread? What's his "I'll take note" comment in response to? 
    MY CHART
    TTC History
    Me: 38, MH: 37 | Met 02/2009 | Started Dating 08/2017 | Married 02/02/2020
    TTC #1 since 02/2020
    2009 | Dx PCOS; likely a misdiagnosis
    07/14/20 | Dx Hashimoto's Thyroditis
    07/21/20 | 1st RE appointment
    07/2120 - 08/20/20 | so much testing; no signs of PCOS
    08/20/20 | Dx Unexplained; AMA
    09/08/20 | IUI #1 Clomid + Trigger + Prometrium | BFN
    09/30/20 | Urology consult; more testing required
    10/2020 | Clomid + OPK + TI + Prometrium | BFN
    10/26/2020 | Starting 2nd IUI cycle, with Letrazole and with a new RE / different clinic
    11/03/2020 | New Dx "poor egg quality"; IUI cancelled in favor of Trigger + TI + Prometrium | BFN
    11/26/2020 | Combo IUI (Clomid + Menopur) + Trigger + Prometrium | BFN
    12/20/2020 | Combo IUI (Clomid + Gonal-F) + Trigger | IUI Cancelled due to thin lining; TI only | BFN
    01/14/2021 | Combo IUI (Letrazole + Menopur) + Trigger | BFN
    02/06/2021 | Switched to a new RE (TEW) ; trying naturally until we complete additional testing 
    03/14/2021 | Hybrid Double IUI, with Zymot (Letrazole, Gonal-F) + Trigger + Endometrin | Ovulated 4 mature eggs but still a BFN ☹️
    04/07/2021 | Natural cycle while we regroup | BFN
    04/09/2021 | Employer announces fertility benefits starting 05/01/2021! | Search for a new doctor who accepts insurance
    05/10/2021 | New RE consult & plan for IVF
    05/13/2021 | Mid-luteal IVF cycle #1 interrupted; had to get cancer genetic screening done to make sure I didn't have the same SDHA gene mutation as MH. 
    06/10/2021 | Aygestin priming IVF cycle #1; opted to Cx after 9 days of stims since only 5-6/12 follicles responded
    07/26/2021 | Attempt #2 at IVF cycle #1 (mid-luteal start): 8 retrieved, 8 MII, 6 fert (1 PN3), 3 Day 5 & 6 blasts: 3AA, 3AA, 6AB; 3 euploid
    08/09/2021 | Rest cycle / unmedicated TTC | Shockingly, a BFP! EDD: 5/25/202 | CP at 4w4d
    09/23/2021 | IVF cycle #2 (mid-luteal start): 14 retrieved, 13 MII, 11 fert, 5 Day 5 & 6 blasts: 2 x 3AA, 2 x 3AB, 3BB; 2 euploid
    11/12/2021 | IVF cycle #3 (mid-luteal start): cancelled due to ovaries being on vacation
    12/20/2021 | Rest cycle / unmedicated TTC + Pregmune Immunology Testing; BFN
    01/22/2022 | Rest cycle / unmedicated TTC + understanding uncovered immunological issues; BFN
    02/18/2022 | Mock transfer cycle! ERA, ReceptivaDx, EMMA/ALICE; start Prednisone to address NK activity
    03/16/2022 | Final, "Hail Mary" super-ovulation + TI cycle before FET; BFP! EDD: 12/21/2022 | MMC 05/08/2022
    05/20/2022 | D&C; recovering... 
    06/21/2022 | Trying naturally until October 2022
    07/21/2022 | BFP! EDD 04/02/2023


    optimistgardener
  • @anniemarie887 I'm on android but it is the same, thank you!
    anniemarie887
  • Yay! Also, y’all I am sorry. You deserve medal for interpreting my typing. I wrote “right about trying” in the last post, I swear every time I post I insert the incorrect word with similar letters to what I intended. Guilty of doing 10 things at once which isn’t wise. 
  • You know you're out of shape when 1 day of 20 squats post PIO shots leave you with DOMS.
    MY CHART
    TTC History
    Me: 38, MH: 37 | Met 02/2009 | Started Dating 08/2017 | Married 02/02/2020
    TTC #1 since 02/2020
    2009 | Dx PCOS; likely a misdiagnosis
    07/14/20 | Dx Hashimoto's Thyroditis
    07/21/20 | 1st RE appointment
    07/2120 - 08/20/20 | so much testing; no signs of PCOS
    08/20/20 | Dx Unexplained; AMA
    09/08/20 | IUI #1 Clomid + Trigger + Prometrium | BFN
    09/30/20 | Urology consult; more testing required
    10/2020 | Clomid + OPK + TI + Prometrium | BFN
    10/26/2020 | Starting 2nd IUI cycle, with Letrazole and with a new RE / different clinic
    11/03/2020 | New Dx "poor egg quality"; IUI cancelled in favor of Trigger + TI + Prometrium | BFN
    11/26/2020 | Combo IUI (Clomid + Menopur) + Trigger + Prometrium | BFN
    12/20/2020 | Combo IUI (Clomid + Gonal-F) + Trigger | IUI Cancelled due to thin lining; TI only | BFN
    01/14/2021 | Combo IUI (Letrazole + Menopur) + Trigger | BFN
    02/06/2021 | Switched to a new RE (TEW) ; trying naturally until we complete additional testing 
    03/14/2021 | Hybrid Double IUI, with Zymot (Letrazole, Gonal-F) + Trigger + Endometrin | Ovulated 4 mature eggs but still a BFN ☹️
    04/07/2021 | Natural cycle while we regroup | BFN
    04/09/2021 | Employer announces fertility benefits starting 05/01/2021! | Search for a new doctor who accepts insurance
    05/10/2021 | New RE consult & plan for IVF
    05/13/2021 | Mid-luteal IVF cycle #1 interrupted; had to get cancer genetic screening done to make sure I didn't have the same SDHA gene mutation as MH. 
    06/10/2021 | Aygestin priming IVF cycle #1; opted to Cx after 9 days of stims since only 5-6/12 follicles responded
    07/26/2021 | Attempt #2 at IVF cycle #1 (mid-luteal start): 8 retrieved, 8 MII, 6 fert (1 PN3), 3 Day 5 & 6 blasts: 3AA, 3AA, 6AB; 3 euploid
    08/09/2021 | Rest cycle / unmedicated TTC | Shockingly, a BFP! EDD: 5/25/202 | CP at 4w4d
    09/23/2021 | IVF cycle #2 (mid-luteal start): 14 retrieved, 13 MII, 11 fert, 5 Day 5 & 6 blasts: 2 x 3AA, 2 x 3AB, 3BB; 2 euploid
    11/12/2021 | IVF cycle #3 (mid-luteal start): cancelled due to ovaries being on vacation
    12/20/2021 | Rest cycle / unmedicated TTC + Pregmune Immunology Testing; BFN
    01/22/2022 | Rest cycle / unmedicated TTC + understanding uncovered immunological issues; BFN
    02/18/2022 | Mock transfer cycle! ERA, ReceptivaDx, EMMA/ALICE; start Prednisone to address NK activity
    03/16/2022 | Final, "Hail Mary" super-ovulation + TI cycle before FET; BFP! EDD: 12/21/2022 | MMC 05/08/2022
    05/20/2022 | D&C; recovering... 
    06/21/2022 | Trying naturally until October 2022
    07/21/2022 | BFP! EDD 04/02/2023


    thankfullyamama
  • Life is crazy! I just took a temp full time position (I am a dialysis registered nurse!) which is 7 7am-7pm shifts in a two week period and my husband just got a new job doing 2 5am-5pm shifts 2 5pm-5am shifts 4 days off. And let me tell u this world was not made for two people to do shift work together! It’s been TOUGH! So I am actively applying for and hoping I get a community nursing job soon that’s an 8:30am-4:30pm Mon-Friday type job because all the little creatures that rely on us to be watered fed and walked are not happy being home alone for 12 hours frequently or shuffled around at family members houses! 
  • @tryingktogku care management? Our care management RNs work those shifts at our hospital
    Spoiler for History 

    Me - 30 DH - 32

    April 2009 - 8+ week MC
    January 2012 - BFP - DS Born 10/21/2012
    May 2013 - BFP - Twins MMC @ 13 weeks D&C
    Oct 2013 -  BFP MC @ 6 weeks
    Dec 2013 -  BFP  DD Born 8/16/14 - Cholestasis at 36+5
    Nov 2016 - BFP MC @ 6 weeks
    Dec 2016 - BFP  DD Born 6/19/17 @ 28+4 Severe Pre-E, IUGR, Cholestasis 
    Nov 2017 - BFP MC @ 6 weeks
    Jan 2017 - BFP MC @ 6 weeks
    Jan 2019 - BFP MC @ 6 weeks
    DH Vasectomy Aug 2019
    Feb 2022 - TTC #4 with IVF - RPL testing
    Protein C and S Deficiency - Blood Thinners for Treatment - Maybe we don't know!
    June 2022 - IVF - 2 embryos - 1 transfered 6/22/22 - Transfer Failed
    July 2022 - FET


  • @mambo5-2 I’m applying outside of our hospital to our community care access center which is a provincially funded program! The care coordinators work normal day job hours! We have care coordinators at the hospital that still work shift work too but that’s what I’m trying to move away from! My husband used to work a 9-5 and I did shift and it worked great but now that he is shift too it’s like we either never see each other and try and work opposite days or we have a heck of a time coordinating care! Trying to even find someone to let our dog out pee is difficult lol I’m hoping I get this new job soon or get to go on a maternity leave soon to recify the situation in the meantime lol 
    fantasyflytemambo5-2
  • @tryingktogku ah, you’re Canadian! Where abouts from? I’m from Ottawa but moved to California ~4 years ago. 
    MY CHART
    TTC History
    Me: 38, MH: 37 | Met 02/2009 | Started Dating 08/2017 | Married 02/02/2020
    TTC #1 since 02/2020
    2009 | Dx PCOS; likely a misdiagnosis
    07/14/20 | Dx Hashimoto's Thyroditis
    07/21/20 | 1st RE appointment
    07/2120 - 08/20/20 | so much testing; no signs of PCOS
    08/20/20 | Dx Unexplained; AMA
    09/08/20 | IUI #1 Clomid + Trigger + Prometrium | BFN
    09/30/20 | Urology consult; more testing required
    10/2020 | Clomid + OPK + TI + Prometrium | BFN
    10/26/2020 | Starting 2nd IUI cycle, with Letrazole and with a new RE / different clinic
    11/03/2020 | New Dx "poor egg quality"; IUI cancelled in favor of Trigger + TI + Prometrium | BFN
    11/26/2020 | Combo IUI (Clomid + Menopur) + Trigger + Prometrium | BFN
    12/20/2020 | Combo IUI (Clomid + Gonal-F) + Trigger | IUI Cancelled due to thin lining; TI only | BFN
    01/14/2021 | Combo IUI (Letrazole + Menopur) + Trigger | BFN
    02/06/2021 | Switched to a new RE (TEW) ; trying naturally until we complete additional testing 
    03/14/2021 | Hybrid Double IUI, with Zymot (Letrazole, Gonal-F) + Trigger + Endometrin | Ovulated 4 mature eggs but still a BFN ☹️
    04/07/2021 | Natural cycle while we regroup | BFN
    04/09/2021 | Employer announces fertility benefits starting 05/01/2021! | Search for a new doctor who accepts insurance
    05/10/2021 | New RE consult & plan for IVF
    05/13/2021 | Mid-luteal IVF cycle #1 interrupted; had to get cancer genetic screening done to make sure I didn't have the same SDHA gene mutation as MH. 
    06/10/2021 | Aygestin priming IVF cycle #1; opted to Cx after 9 days of stims since only 5-6/12 follicles responded
    07/26/2021 | Attempt #2 at IVF cycle #1 (mid-luteal start): 8 retrieved, 8 MII, 6 fert (1 PN3), 3 Day 5 & 6 blasts: 3AA, 3AA, 6AB; 3 euploid
    08/09/2021 | Rest cycle / unmedicated TTC | Shockingly, a BFP! EDD: 5/25/202 | CP at 4w4d
    09/23/2021 | IVF cycle #2 (mid-luteal start): 14 retrieved, 13 MII, 11 fert, 5 Day 5 & 6 blasts: 2 x 3AA, 2 x 3AB, 3BB; 2 euploid
    11/12/2021 | IVF cycle #3 (mid-luteal start): cancelled due to ovaries being on vacation
    12/20/2021 | Rest cycle / unmedicated TTC + Pregmune Immunology Testing; BFN
    01/22/2022 | Rest cycle / unmedicated TTC + understanding uncovered immunological issues; BFN
    02/18/2022 | Mock transfer cycle! ERA, ReceptivaDx, EMMA/ALICE; start Prednisone to address NK activity
    03/16/2022 | Final, "Hail Mary" super-ovulation + TI cycle before FET; BFP! EDD: 12/21/2022 | MMC 05/08/2022
    05/20/2022 | D&C; recovering... 
    06/21/2022 | Trying naturally until October 2022
    07/21/2022 | BFP! EDD 04/02/2023


    thankfullyamama
  • @acleverusername I’m in a small northern city in Ontario! Beautiful if you appreciate nature. Very boring if you don’t haha where are you from!? California seems like a dream after this hell of a winter!
    acleverusername
  • I totally get the desire to try anything and everything to get KUed but this feels like an empty publicity stunt and God help anyone reading People without validating info and then endangering themselves by going out there and eating raw meat willy nilly: https://people.com/food/heidi-montag-seen-eating-raw-animal-organs-to-help-fertility-issues-i-love-trying-new-things/
    MY CHART
    TTC History
    Me: 38, MH: 37 | Met 02/2009 | Started Dating 08/2017 | Married 02/02/2020
    TTC #1 since 02/2020
    2009 | Dx PCOS; likely a misdiagnosis
    07/14/20 | Dx Hashimoto's Thyroditis
    07/21/20 | 1st RE appointment
    07/2120 - 08/20/20 | so much testing; no signs of PCOS
    08/20/20 | Dx Unexplained; AMA
    09/08/20 | IUI #1 Clomid + Trigger + Prometrium | BFN
    09/30/20 | Urology consult; more testing required
    10/2020 | Clomid + OPK + TI + Prometrium | BFN
    10/26/2020 | Starting 2nd IUI cycle, with Letrazole and with a new RE / different clinic
    11/03/2020 | New Dx "poor egg quality"; IUI cancelled in favor of Trigger + TI + Prometrium | BFN
    11/26/2020 | Combo IUI (Clomid + Menopur) + Trigger + Prometrium | BFN
    12/20/2020 | Combo IUI (Clomid + Gonal-F) + Trigger | IUI Cancelled due to thin lining; TI only | BFN
    01/14/2021 | Combo IUI (Letrazole + Menopur) + Trigger | BFN
    02/06/2021 | Switched to a new RE (TEW) ; trying naturally until we complete additional testing 
    03/14/2021 | Hybrid Double IUI, with Zymot (Letrazole, Gonal-F) + Trigger + Endometrin | Ovulated 4 mature eggs but still a BFN ☹️
    04/07/2021 | Natural cycle while we regroup | BFN
    04/09/2021 | Employer announces fertility benefits starting 05/01/2021! | Search for a new doctor who accepts insurance
    05/10/2021 | New RE consult & plan for IVF
    05/13/2021 | Mid-luteal IVF cycle #1 interrupted; had to get cancer genetic screening done to make sure I didn't have the same SDHA gene mutation as MH. 
    06/10/2021 | Aygestin priming IVF cycle #1; opted to Cx after 9 days of stims since only 5-6/12 follicles responded
    07/26/2021 | Attempt #2 at IVF cycle #1 (mid-luteal start): 8 retrieved, 8 MII, 6 fert (1 PN3), 3 Day 5 & 6 blasts: 3AA, 3AA, 6AB; 3 euploid
    08/09/2021 | Rest cycle / unmedicated TTC | Shockingly, a BFP! EDD: 5/25/202 | CP at 4w4d
    09/23/2021 | IVF cycle #2 (mid-luteal start): 14 retrieved, 13 MII, 11 fert, 5 Day 5 & 6 blasts: 2 x 3AA, 2 x 3AB, 3BB; 2 euploid
    11/12/2021 | IVF cycle #3 (mid-luteal start): cancelled due to ovaries being on vacation
    12/20/2021 | Rest cycle / unmedicated TTC + Pregmune Immunology Testing; BFN
    01/22/2022 | Rest cycle / unmedicated TTC + understanding uncovered immunological issues; BFN
    02/18/2022 | Mock transfer cycle! ERA, ReceptivaDx, EMMA/ALICE; start Prednisone to address NK activity
    03/16/2022 | Final, "Hail Mary" super-ovulation + TI cycle before FET; BFP! EDD: 12/21/2022 | MMC 05/08/2022
    05/20/2022 | D&C; recovering... 
    06/21/2022 | Trying naturally until October 2022
    07/21/2022 | BFP! EDD 04/02/2023


  • Yikes! And also, eewwwww! 
  • As someone who loves sushi, poke, steak tartare… GROSS. 
    kiki047acleverusername
Sign In or Register to comment.
Choose Another Board
Search Boards
"
"